PDB entry 2bku

View 2bku on RCSB PDB site
Description: kap95p:rangtp complex
Class: nuclear transport
Keywords: nuclear transport, importin-beta, rangtp, GTP binding, protein transport
Deposited on 2005-02-21, released 2005-05-04
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.226
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTP-binding nuclear protein ran
    Species: CANIS FAMILIARIS [TaxId:9615]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BKU (Start-9)
    • Uniprot P62825 (Start-176)
    Domains in SCOPe 2.04: d2bkua_
  • Chain 'B':
    Compound: importin beta-1 subunit
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q06142 (0-860)
      • conflict (253)
    Domains in SCOPe 2.04: d2bkub1
  • Chain 'C':
    Compound: GTP-binding nuclear protein ran
    Species: CANIS FAMILIARIS [TaxId:9615]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BKU (Start-9)
    • Uniprot P62825 (Start-176)
    Domains in SCOPe 2.04: d2bkuc_
  • Chain 'D':
    Compound: importin beta-1 subunit
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q06142 (0-860)
      • conflict (253)
    Domains in SCOPe 2.04: d2bkud_
  • Heterogens: GTP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bkuA (A:)
    maaqgepqvqfklvlvgdggtgkttfvkrhltgefekkyvptlgvevhplvfhtnrgpik
    fnvwdtagqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlc
    gnkvdikdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bkuA (A:)
    vqfklvlvgdggtgkttfvkrhltgefekkyvptlgvevhplvfhtnrgpikfnvwdtag
    qekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdikd
    rkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bkuB (B:)
    mstaefaqllensilspdqnirltsetqlkklsndnflqfaglssqvlidentklegril
    aaltlknelvskdsvktqqfaqrwitqvspeaknqiktnaltalvsieprianaaaqlia
    aiadielphgawpelmkimvdntgaeqpenvkrasllalgymcesadpqsqalvsssnni
    liaivqgaqstetskavrlaalnaladslifiknnmeregernylmqvvceatqaediev
    qaaafgclckimskyytfmkpymeqalyaltiatmkspndkvasmtvefwsticeeeidi
    ayelaqfpqsplqsynfalssikdvvpnllnlltrqnedpedddwnvsmsagaclqlfaq
    ncgnhilepvlefveqnitadnwrnreaavmafgsimdgpdkvqrtyyvhqalpsilnlm
    ndqslqvkettawcigriadsvaesidpqqhlpgvvqacliglqdhpkvatncswtiinl
    veqlaeatpspiynfypalvdgligaanridnefnarasafsalttmveyatdtvaetsa
    sistfvmdklgqtmsvdenqltledaqslqelqsniltvlaavirkspssvepvadmlmg
    lffrllekkdsafieddvfyaisalaaslgkgfekyletfspyllkalnqvdspvsitav
    gfiadisnsleedfrrysdammnvlaqmisnpnarrelkpavlsvfgdiasnigadfipy
    lndimalcvaaqntkpengtlealdyqikvleavldayvgivaglhdkpealfpyvgtif
    qfiaqvaedpqlysedatsraavgligdiaamfpdgsikqfygqdwvidyikrtrsgqlf
    sqatkdtarwareqqkrqlsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bkuB (B:)
    mstaefaqllensilspdqnirltsetqlkklsndnflqfaglssqvlidentklegril
    aaltlknelvskdsvktqqfaqrwitqvspeaknqiktnaltalvsieprianaaaqlia
    aiadielphgawpelmkimvdntgaeqpenvkrasllalgymcesadalvsssnniliai
    vqgaqstetskavrlaalnaladslifiknnmeregernylmqvvceatqaedievqaaa
    fgclckimskyytfmkpymeqalyaltiatmkspndkvasmtvefwsticeeeidiayel
    aqfpqsplqsynfalssikdvvpnllnlltrqnedpedddwnvsmsagaclqlfaqncgn
    hilepvlefveqnitadnwrnreaavmafgsimdgpdkvqrtyyvhqalpsilnlmndqs
    lqvkettawcigriadsvaesidpqqhlpgvvqacliglqdhpkvatncswtiinlveql
    aeatpspiynfypalvdgligaanridnefnarasafsalttmveyatdtvaetsasist
    fvmdklgqtmsvdenqltledaqslqelqsniltvlaavirkspssvepvadmlmglffr
    llekkdsafieddvfyaisalaaslgkgfekyletfspyllkalnqvdspvsitavgfia
    disnsleedfrrysdammnvlaqmisnpnarrelkpavlsvfgdiasnigadfipylndi
    malcvaaqntkpengtlealdyqikvleavldayvgivaglhdkpealfpyvgtifqfia
    qvaedpqlysedatsraavgligdiaamfpdgsikqfygqdwvidyikrtrsgqlfsqat
    kdtarwareqqkrqlsl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2bkuC (C:)
    maaqgepqvqfklvlvgdggtgkttfvkrhltgefekkyvptlgvevhplvfhtnrgpik
    fnvwdtagqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlc
    gnkvdikdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bkuC (C:)
    vqfklvlvgdggtgkttfvkrhltgefekkyvptlgvevhplvfhtnrgpikfnvwdtag
    qekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdikd
    rkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2bkuD (D:)
    mstaefaqllensilspdqnirltsetqlkklsndnflqfaglssqvlidentklegril
    aaltlknelvskdsvktqqfaqrwitqvspeaknqiktnaltalvsieprianaaaqlia
    aiadielphgawpelmkimvdntgaeqpenvkrasllalgymcesadpqsqalvsssnni
    liaivqgaqstetskavrlaalnaladslifiknnmeregernylmqvvceatqaediev
    qaaafgclckimskyytfmkpymeqalyaltiatmkspndkvasmtvefwsticeeeidi
    ayelaqfpqsplqsynfalssikdvvpnllnlltrqnedpedddwnvsmsagaclqlfaq
    ncgnhilepvlefveqnitadnwrnreaavmafgsimdgpdkvqrtyyvhqalpsilnlm
    ndqslqvkettawcigriadsvaesidpqqhlpgvvqacliglqdhpkvatncswtiinl
    veqlaeatpspiynfypalvdgligaanridnefnarasafsalttmveyatdtvaetsa
    sistfvmdklgqtmsvdenqltledaqslqelqsniltvlaavirkspssvepvadmlmg
    lffrllekkdsafieddvfyaisalaaslgkgfekyletfspyllkalnqvdspvsitav
    gfiadisnsleedfrrysdammnvlaqmisnpnarrelkpavlsvfgdiasnigadfipy
    lndimalcvaaqntkpengtlealdyqikvleavldayvgivaglhdkpealfpyvgtif
    qfiaqvaedpqlysedatsraavgligdiaamfpdgsikqfygqdwvidyikrtrsgqlf
    sqatkdtarwareqqkrqlsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bkuD (D:)
    mstaefaqllensilspdqnirltsetqlkklsndnflqfaglssqvlidentklegril
    aaltlknelvskdsvktqqfaqrwitqvspeaknqiktnaltalvsieprianaaaqlia
    aiadielphgawpelmkimvdntgaeqpenvkrasllalgymcesadpqsqalvsssnni
    liaivqgaqstetskavrlaalnaladslifiknnmeregernylmqvvceatqaediev
    qaaafgclckimskyytfmkpymeqalyaltiatmkspndkvasmtvefwsticeeeidi
    ayelaqfpqsplqsynfalssikdvvpnllnlltrqnedpedddwnvsmsagaclqlfaq
    ncgnhilepvlefveqnitadnwrnreaavmafgsimdgpdkvqrtyyvhqalpsilnlm
    ndqslqvkettawcigriadsvaesidpqqhlpgvvqacliglqdhpkvatncswtiinl
    veqlaeatpspiynfypalvdgligaanridnefnarasafsalttmveyatdtvaetsa
    sistfvmdklgqtmsvedaqslqelqsniltvlaavirkspssvepvadmlmglffrlle
    kkdsafieddvfyaisalaaslgkgfekyletfspyllkalnqvdspvsitavgfiadis
    nsleedfrrysdammnvlaqmisnpnarrelkpavlsvfgdiasnigadfipylndimal
    cvaaqntkpengtlealdyqikvleavldayvgivaglhdkpealfpyvgtifqfiaqva
    edpqlysedatsraavgligdiaamfpdgsikqfygqdwvidyikrtrsgqlfsqatkdt
    arwareqqkrqlsl