SCOPe 2.07: Domain d1vrnh1: 1vrn H:1-36

Lineage for d1vrnh1 (1vrn H:1-36)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.10: Photosystem II reaction centre subunit H, transmembrane region [81490] (2 families)

5. Family f.23.10.1: Photosystem II reaction centre subunit H, transmembrane region [81489] (1 protein)

6. Protein Photosystem II reaction centre subunit H, transmembrane region [81488] (4 species)

7. Species Rhodopseudomonas viridis [TaxId:1079] [81485] (26 PDB entries)
   synonym: blastochloris viridis

8. Domain d1vrnh1: 1vrn H:1-36 [197587]
   Other proteins in same PDB: d1vrnc_, d1vrnh2, d1vrnl_, d1vrnm_
   automated match to d6prch2
   complexed with bcb, bpb, fe2, hem, lda, mq9, ns5, so4, uq7

Details for d1vrnh1

PDB Entry: 1vrn, 2.2 Å

PDB Description: photosynthetic reaction center blastochloris viridis (atcc)

PDB Compounds: (H:) reaction center protein h chain

SCOPe Domain Sequences for d1vrnh1:

Sequence; same for both SEQRES and ATOM records:

>d1vrnh1 f.23.10.1 (H:1-36) Photosystem II reaction centre subunit H, transmembrane region {Rhodopseudomonas viridis [TaxId: 1079]}
myhgalaqhldiaqlvwyaqwlviwtvvllylrred

Timeline for d1vrnh1:

• d1vrnh1 first appeared in SCOPe 2.03
  
• d1vrnh1 appears in SCOPe 2.06
  
• d1vrnh1 appears in the current release, SCOPe 2.08