SCOPe 2.07: Domain d1vrnl_: 1vrn L:

Lineage for d1vrnl_ (1vrn L:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
   automatically mapped to Pfam PF00124

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein automated matches [190224] (14 species)
   not a true protein

7. Species Blastochloris viridis [TaxId:1079] [187141] (8 PDB entries)

8. Domain d1vrnl_: 1vrn L: [161868]
   Other proteins in same PDB: d1vrnc_, d1vrnh1, d1vrnh2
   automated match to d1prcl_
   complexed with bcb, bpb, fe2, hem, lda, mq9, ns5, so4, uq7

Details for d1vrnl_

PDB Entry: 1vrn, 2.2 Å

PDB Description: photosynthetic reaction center blastochloris viridis (atcc)

PDB Compounds: (L:) reaction center protein l chain

SCOPe Domain Sequences for d1vrnl_:

Sequence; same for both SEQRES and ATOM records:

>d1vrnl_ f.26.1.1 (L:) automated matches {Blastochloris viridis [TaxId: 1079]}
allsferkyrvrggtliggdlfdfwvgpyfvgffgvsaiffiflgvsligyaasqgptwd
pfaisinppdlkyglgaaplleggfwqaitvcalgafiswmlreveisrklgigwhvpla
fcvpifmfcvlqvfrplllgswghafpygilshldwvnnfgyqylnwhynpghmssvsfl
fvnamalglhgglilsvanpgdgdkvktaehenqyfrdvvgysigalsihrlglflasni
fltgafgtiasgpfwtrgwpewwgwwldipfws

Timeline for d1vrnl_:

• d1vrnl_ first appeared in SCOPe 2.01
  
• d1vrnl_ appears in SCOPe 2.06
  
• d1vrnl_ appears in the current release, SCOPe 2.08