SCOPe 2.05: Domain d1ccza1: 1ccz A:1-93

Lineage for d1ccza1 (1ccz A:1-93)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein CD2-binding domain of CD58, N-terminal domain [48743] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48744] (3 PDB entries)

8. Domain d1ccza1: 1ccz A:1-93 [19758]
   Other proteins in same PDB: d1ccza2
   complexed with nag

Details for d1ccza1

PDB Entry: 1ccz, 1.8 Å

PDB Description: crystal structure of the cd2-binding domain of cd58 (lymphocyte function-associated antigen 3) at 1.8-a resolution

PDB Compounds: (A:) protein (cd58)

SCOPe Domain Sequences for d1ccza1:

Sequence; same for both SEQRES and ATOM records:

>d1ccza1 b.1.1.1 (A:1-93) CD2-binding domain of CD58, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
fsqqiygvvygnvtfhvpsnvplkevlwkkqkdkvaelensefrafssfknrvyldtvsg
sltiynltssdedeyemespnitdtmkfflyvl

Timeline for d1ccza1:

• d1ccza1 first appeared (with stable ids) in SCOP 1.55
  
• d1ccza1 appears in SCOPe 2.04
  
• d1ccza1 appears in SCOPe 2.06
  
• d1ccza1 appears in the current release, SCOPe 2.08