SCOPe 2.08: Domain d1sz2b2: 1sz2 B:3-111

Lineage for d1sz2b2 (1sz2 B:3-111)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.7: Glucokinase [110627] (2 proteins)
   Pfam PF02685

6. Protein Glucokinase Glk, N-terminal domain [418996] (1 species)

7. Species Escherichia coli [TaxId:562] [419468] (2 PDB entries)
   Uniprot P46880

8. Domain d1sz2b2: 1sz2 B:3-111 [197519]
   Other proteins in same PDB: d1sz2a3, d1sz2b3
   complexed with bgc

Details for d1sz2b2

PDB Entry: 1sz2, 2.2 Å

PDB Description: crystal structure of e. coli glucokinase in complex with glucose

PDB Compounds: (B:) Glucokinase

SCOPe Domain Sequences for d1sz2b2:

Sequence; same for both SEQRES and ATOM records:

>d1sz2b2 c.55.1.7 (B:3-111) Glucokinase Glk, N-terminal domain {Escherichia coli [TaxId: 562]}
kyalvgdvggtnarlalcdiasgeisqaktysgldypsleavirvyleehkvevkdgcia
iacpitgdwvamtnhtwafsiaemkknlgfshleiindftavsmaipml

Timeline for d1sz2b2:

• d1sz2b2 first appeared in SCOPe 2.03
  
• d1sz2b2 appears in SCOPe 2.07