Class b: All beta proteins [48724] (177 folds) |
Fold b.61: Streptavidin-like [50875] (8 superfamilies) barrel, closed; n=8, S=10; meander |
Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) |
Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins) |
Protein Streptavidin [50878] (1 species) |
Species Streptomyces avidinii [TaxId:1895] [50879] (125 PDB entries) |
Domain d3ry1c_: 3ry1 C: [197441] automated match to d1n9mc_ complexed with mpd, mrd |
PDB Entry: 3ry1 (more details), 1.03 Å
SCOPe Domain Sequences for d3ry1c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ry1c_ b.61.1.1 (C:) Streptavidin {Streptomyces avidinii [TaxId: 1895]} agitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalg wtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvk p
Timeline for d3ry1c_: