Class b: All beta proteins [48724] (174 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.0: automated matches [191364] (1 protein) not a true family |
Protein automated matches [190438] (11 species) not a true protein |
Species Human enterovirus 71 [TaxId:39054] [189708] (4 PDB entries) |
Domain d4fvba_: 4fvb A: [197381] automated match to d2hrva_ complexed with zn; mutant |
PDB Entry: 4fvb (more details), 1.9 Å
SCOPe Domain Sequences for d4fvba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fvba_ b.47.1.0 (A:) automated matches {Human enterovirus 71 [TaxId: 39054]} sgaiyvgnfrvvnrhlathndwanlvwedssrdllvssttaqgcdtiarcncqtgvyycn srrkhypvsfskpsliyveaseyyparyqshlmlaqghsepgdaggilrcqhgvvgivst ggnglvgfadvrdllwld
Timeline for d4fvba_: