Lineage for d3b2ja_ (3b2j A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1324198Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 1324199Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 1324658Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 1324846Protein Liver fatty acid binding protein [50866] (2 species)
  7. 1324847Species Human (Homo sapiens) [TaxId:9606] [141464] (15 PDB entries)
    Uniprot P07148 1-127
  8. 1324854Domain d3b2ja_: 3b2j A: [197369]
    automated match to d2f73a1
    complexed with iod, plm

Details for d3b2ja_

PDB Entry: 3b2j (more details), 2 Å

PDB Description: Iodide derivative of human LFABP
PDB Compounds: (A:) Fatty acid-binding protein, liver

SCOPe Domain Sequences for d3b2ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b2ja_ b.60.1.2 (A:) Liver fatty acid binding protein {Human (Homo sapiens) [TaxId: 9606]}
gssfsgkyqlqsqenfeafmkaiglpeeliqkgkdikgvseivqngkhfkftitagskvi
qneftvgeeceletmtgekvktvvqlegdnklvttfkniksvtelngdiitntmtlgdiv
fkriskrigt

SCOPe Domain Coordinates for d3b2ja_:

Click to download the PDB-style file with coordinates for d3b2ja_.
(The format of our PDB-style files is described here.)

Timeline for d3b2ja_: