SCOPe 2.02: Domain d3b2ja_: 3b2j A:

Lineage for d3b2ja_ (3b2j A:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
   ten-stranded meander beta-sheet folded upon itself
   relates to the common fold by opening the barrel and insertion of beta-hairpin

6. Protein Liver fatty acid binding protein [50866] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141464] (3 PDB entries)
   Uniprot P07148 1-127

8. Domain d3b2ja_: 3b2j A: [197369]
   automated match to d2f73a1
   complexed with iod, plm

Details for d3b2ja_

PDB Entry: 3b2j, 2 Å

PDB Description: Iodide derivative of human LFABP

PDB Compounds: (A:) Fatty acid-binding protein, liver

SCOPe Domain Sequences for d3b2ja_:

Sequence; same for both SEQRES and ATOM records:

>d3b2ja_ b.60.1.2 (A:) Liver fatty acid binding protein {Human (Homo sapiens) [TaxId: 9606]}
gssfsgkyqlqsqenfeafmkaiglpeeliqkgkdikgvseivqngkhfkftitagskvi
qneftvgeeceletmtgekvktvvqlegdnklvttfkniksvtelngdiitntmtlgdiv
fkriskrigt

Timeline for d3b2ja_:

• d3b2ja_ is new in SCOPe 2.02-stable
  
• d3b2ja_ appears in SCOPe 2.03
  
• d3b2ja_ appears in the current release, SCOPe 2.08, called d3b2ja1