Lineage for d1wipb1 (1wip B:1-97)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1103263Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1103355Protein CD4 V-set domains [48737] (2 species)
  7. 1103356Species Human (Homo sapiens) [TaxId:9606] [48738] (26 PDB entries)
  8. 1103387Domain d1wipb1: 1wip B:1-97 [19734]
    Other proteins in same PDB: d1wipa3, d1wipa4, d1wipb3, d1wipb4
    domains 1 and 3

Details for d1wipb1

PDB Entry: 1wip (more details), 4 Å

PDB Description: structure of t-cell surface glycoprotein cd4, monoclinic crystal form
PDB Compounds: (B:) T-cell surface glycoprotein cd4

SCOPe Domain Sequences for d1wipb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wipb1 b.1.1.1 (B:1-97) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]}
kkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrrs
lwdqgnfpliiknlkiedsdtyicevedqkeevqllv

SCOPe Domain Coordinates for d1wipb1:

Click to download the PDB-style file with coordinates for d1wipb1.
(The format of our PDB-style files is described here.)

Timeline for d1wipb1: