Lineage for d4kkna_ (4kkn A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1103263Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1105645Protein automated matches [190119] (15 species)
    not a true protein
  7. 1105646Species Bos taurus [TaxId:9913] [197337] (1 PDB entry)
  8. 1105647Domain d4kkna_: 4kkn A: [197338]
    automated match to d2x44d_

Details for d4kkna_

PDB Entry: 4kkn (more details), 2.25 Å

PDB Description: crystal structure of bovine ctla-4, psi-nysgrc-012704
PDB Compounds: (A:) Cytotoxic T-lymphocyte associated protein 4

SCOPe Domain Sequences for d4kkna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kkna_ b.1.1.1 (A:) automated matches {Bos taurus [TaxId: 9913]}
gmnvtqppvvlassrgvasfsceyessgkadevrvtvlreagsqvtevcagtymvedelt
flddstcigtsrgnkvnltiqglramdtglyvckvelmypppyyvgigngtqiyvid

SCOPe Domain Coordinates for d4kkna_:

Click to download the PDB-style file with coordinates for d4kkna_.
(The format of our PDB-style files is described here.)

Timeline for d4kkna_: