Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (15 species) not a true protein |
Species Bos taurus [TaxId:9913] [197337] (1 PDB entry) |
Domain d4kkna_: 4kkn A: [197338] automated match to d2x44d_ |
PDB Entry: 4kkn (more details), 2.25 Å
SCOPe Domain Sequences for d4kkna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kkna_ b.1.1.1 (A:) automated matches {Bos taurus [TaxId: 9913]} gmnvtqppvvlassrgvasfsceyessgkadevrvtvlreagsqvtevcagtymvedelt flddstcigtsrgnkvnltiqglramdtglyvckvelmypppyyvgigngtqiyvid
Timeline for d4kkna_: