Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins) |
Protein N-terminal domain of CD4 [48737] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [48738] (13 PDB entries) |
Domain d1cdj_1: 1cdj 1-97 [19725] Other proteins in same PDB: d1cdj_2 |
PDB Entry: 1cdj (more details), 2.5 Å
SCOP Domain Sequences for d1cdj_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cdj_1 b.1.1.1 (1-97) N-terminal domain of CD4 {Human (Homo sapiens)} kkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrrs lwdqgnfpliiknlkiedsdtyicevedqkeevqllv
Timeline for d1cdj_1: