SCOP 1.65: Domain d1cdj_1: 1cdj 1-97

Lineage for d1cdj_1 (1cdj 1-97)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)

6. Protein N-terminal domain of CD4 [48737] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48738] (13 PDB entries)

8. Domain d1cdj_1: 1cdj 1-97 [19725]
   Other proteins in same PDB: d1cdj_2

Details for d1cdj_1

PDB Entry: 1cdj, 2.5 Å

PDB Description: structure of t-cell surface glycoprotein cd4

SCOP Domain Sequences for d1cdj_1:

Sequence; same for both SEQRES and ATOM records:

>d1cdj_1 b.1.1.1 (1-97) N-terminal domain of CD4 {Human (Homo sapiens)}
kkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrrs
lwdqgnfpliiknlkiedsdtyicevedqkeevqllv

Timeline for d1cdj_1:

• d1cdj_1 first appeared (with stable ids) in SCOP 1.55
  
• d1cdj_1 appears in SCOP 1.63
  
• d1cdj_1 appears in SCOP 1.67
  
• d1cdj_1 appears in the current release, SCOPe 2.08, called d1cdja1