Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.73: RuBisCO, small subunit [55238] (1 superfamily) alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta |
Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families) |
Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins) |
Protein automated matches [190066] (7 species) not a true protein |
Species Oryza sativa [TaxId:39947] [195635] (2 PDB entries) |
Domain d3axmu_: 3axm U: [197225] Other proteins in same PDB: d3axma1, d3axma2, d3axmb1, d3axmb2, d3axmc1, d3axmc2, d3axmd1, d3axmd2, d3axme1, d3axme2, d3axmf1, d3axmf2, d3axmg1, d3axmg2, d3axmh1, d3axmh2 automated match to d1wdds_ complexed with 6pg, mg |
PDB Entry: 3axm (more details), 1.65 Å
SCOPe Domain Sequences for d3axmu_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3axmu_ d.73.1.1 (U:) automated matches {Oryza sativa [TaxId: 39947]} xmqvwpiegikkfetlsylppltvedllkqieyllrskwvpclefskvgfvyrenhrspg yydgrywtmwklpmfgctdatqvlkeleeakkaypdafvriigfdnvrqvqlisfiaykp pgc
Timeline for d3axmu_: