Lineage for d4k4ya1 (4k4y A:1-462)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2622069Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 2622070Superfamily e.8.1: DNA/RNA polymerases [56672] (8 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 2623022Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (3 proteins)
  6. 2623336Protein automated matches [190260] (25 species)
    not a true protein
  7. 2623560Species Human coxsackievirus B3 [TaxId:12072] [193138] (3 PDB entries)
  8. 2623569Domain d4k4ya1: 4k4y A:1-462 [197201]
    Other proteins in same PDB: d4k4ya2, d4k4ye2, d4k4yi2, d4k4ym2
    automated match to d1ra6a_
    protein/RNA complex; complexed with act, dct, gol

Details for d4k4ya1

PDB Entry: 4k4y (more details), 2.72 Å

PDB Description: coxsackievirus b3 polymerase elongation complex (r2+1_form)
PDB Compounds: (A:) RNA-dependent RNA polymerase

SCOPe Domain Sequences for d4k4ya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k4ya1 e.8.1.4 (A:1-462) automated matches {Human coxsackievirus B3 [TaxId: 12072]}
geiefiesskdagfpvintpsktklepsvfhqvfegnkepavlrsgdprlkanfeeaifs
kyignvnthvdeymleavdhyagqlatldistepmkledavygteglealdlttsagypy
valgikkrdilskktkdltklkecmdkyglnlpmvtyvkdelrsiekvakgksrlieass
lndsvamrqtfgnlyktfhlnpgvvtgsavgcdpdlfwskipvmldghliafdysgydas
lspvwfaclkmileklgythketnyidylcnshhlyrdkhyfvrggmpsgcsgtsifnsm
inniiirtlmlkvykgidldqfrmiaygddviasypwpidasllaeagkgyglimtpadk
gecfnevtwtnvtflkryfradeqypflvhpvmpmkdihesirwtkdpkntqdhvrslcl
lawhngeheyeefirkirsvpvgrcltlpafstlrrkwldsf

SCOPe Domain Coordinates for d4k4ya1:

Click to download the PDB-style file with coordinates for d4k4ya1.
(The format of our PDB-style files is described here.)

Timeline for d4k4ya1: