SCOPe 2.08: Domain d4ja8b_: 4ja8 B:

Lineage for d4ja8b_ (4ja8 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
   consists of two intertwined (sub)domains related by pseudo dyad; duplication
   3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest

4. Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families)
   the constituent families form similar dimers

5. Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
   the active site is between the two identical subunits

6. Protein automated matches [190072] (22 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189131] (10 PDB entries)

8. Domain d4ja8b_: 4ja8 B: [197105]
   Other proteins in same PDB: d4ja8a2
   automated match to d1lwda_
   complexed with 1k9, ca, gol, ndp; mutant

Details for d4ja8b_

PDB Entry: 4ja8, 1.55 Å

PDB Description: complex of mitochondrial isocitrate dehydrogenase r140q mutant with agi-6780 inhibitor

PDB Compounds: (B:) Isocitrate dehydrogenase [NADP], mitochondrial

SCOPe Domain Sequences for d4ja8b_:

Sequence; same for both SEQRES and ATOM records:

>d4ja8b_ c.77.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rikvakpvvemdgdemtriiwqfikeklilphvdiqlkyfdlglpnrdqtddqvtidsal
atqkysvavkcatitpdearveefklkkmwkspngtiqnilggtvfrepiickniprlvp
gwtkpitigrhahgdqykatdfvadragtfkmvftpkdgsgvkewevynfpaggvgmgmy
ntdesisgfahscfqyaiqkkwplymstkntilkaydgrfkdifqeifdkhyktdfdknk
iwyehrliddmvaqvlkssggfvwacknydgdvqsdilaqgfgslglmtsvlvcpdgkti
eaeaahgtvtrhyrehqkgrptstnpiasifawtrglehrgkldgnqdlirfaqmlekvc
vetvesgamtkdlagcihglsnvklnehflnttdfldtiksnldra

Timeline for d4ja8b_:

• d4ja8b_ first appeared in SCOPe 2.02
  
• d4ja8b_ appears in SCOPe 2.07