SCOPe 2.05: Domain d2yoya_: 2yoy A:

Lineage for d2yoya_ (2yoy A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (43 species)
   not a true protein

7. Species Bacillus amyloliquefaciens [TaxId:1390] [197052] (3 PDB entries)

8. Domain d2yoya_: 2yoy A: [197053]
   automated match to d2bena_
   complexed with cu1, edo

Details for d2yoya_

PDB Entry: 2yoy, 1.7 Å

PDB Description: Bacillus amyloliquefaciens CBM33 in complex with Cu(I) reduced using ascorbate

PDB Compounds: (A:) rbam17540

SCOPe Domain Sequences for d2yoya_:

Sequence; same for both SEQRES and ATOM records:

>d2yoya_ b.1.18.0 (A:) automated matches {Bacillus amyloliquefaciens [TaxId: 1390]}
hgyikepvsraymgalekqtmgwtaaaqkygsvidnpqsvegpkgfpaagppdgriasan
ggsgqidfgldkqtadhwvkqnirggfntftwhytaphatskwhyyitkknwnpnkplsr
defeligtvnhdgskadtnlthkifvptdrsgyhiilgvwdvadtsnafynvidvnlt

Timeline for d2yoya_:

• d2yoya_ first appeared in SCOPe 2.02
  
• d2yoya_ appears in SCOPe 2.04
  
• d2yoya_ appears in SCOPe 2.06
  
• d2yoya_ appears in the current release, SCOPe 2.08