Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
Protein automated matches [190226] (43 species) not a true protein |
Species Bacillus amyloliquefaciens [TaxId:1390] [197052] (3 PDB entries) |
Domain d2yoya_: 2yoy A: [197053] automated match to d2bena_ complexed with cu1, edo |
PDB Entry: 2yoy (more details), 1.7 Å
SCOPe Domain Sequences for d2yoya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yoya_ b.1.18.0 (A:) automated matches {Bacillus amyloliquefaciens [TaxId: 1390]} hgyikepvsraymgalekqtmgwtaaaqkygsvidnpqsvegpkgfpaagppdgriasan ggsgqidfgldkqtadhwvkqnirggfntftwhytaphatskwhyyitkknwnpnkplsr defeligtvnhdgskadtnlthkifvptdrsgyhiilgvwdvadtsnafynvidvnlt
Timeline for d2yoya_: