Lineage for d3vzka_ (3vzk A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1118105Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1118106Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1119317Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)
  6. 1119362Protein Xylanase II [49979] (17 species)
    Partial overlap with common fold and the active sites of the other endoglucanases
  7. 1119385Species Bacillus circulans [TaxId:1397] [49980] (16 PDB entries)
  8. 1119387Domain d3vzka_: 3vzk A: [197050]
    automated match to d1c5ha_
    complexed with so4; mutant

Details for d3vzka_

PDB Entry: 3vzk (more details), 1.55 Å

PDB Description: Crystal structure of the Bacillus circulans endo-beta-(1,4)-xylanase (BcX) N35E mutant
PDB Compounds: (A:) endo-1,4-beta-xylanase

SCOPe Domain Sequences for d3vzka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vzka_ b.29.1.11 (A:) Xylanase II {Bacillus circulans [TaxId: 1397]}
astdywqnwtdgggivnavngsggnysvnwsntgefvvgkgwttgspfrtinynagvwap
ngngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidg
drttftqywsvrqskrptgsnatitftnhvnawkshgmnlgsnwayqvmategyqssgss
nvtvw

SCOPe Domain Coordinates for d3vzka_:

Click to download the PDB-style file with coordinates for d3vzka_.
(The format of our PDB-style files is described here.)

Timeline for d3vzka_: