Lineage for d4aq6b_ (4aq6 B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1807020Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 1807021Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 1807602Family b.82.1.0: automated matches [191354] (1 protein)
    not a true family
  6. 1807603Protein automated matches [190388] (20 species)
    not a true protein
  7. 1807665Species Pseudomonas putida [TaxId:160488] [196877] (3 PDB entries)
  8. 1807679Domain d4aq6b_: 4aq6 B: [196879]
    automated match to d1eyba_
    complexed with b3p, fe, omd

Details for d4aq6b_

PDB Entry: 4aq6 (more details), 1.98 Å

PDB Description: substrate bound homogentisate 1,2-dioxygenase
PDB Compounds: (B:) homogentisate 1,2-dioxygenase

SCOPe Domain Sequences for d4aq6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4aq6b_ b.82.1.0 (B:) automated matches {Pseudomonas putida [TaxId: 160488]}
lhylsgfgnefasealpgalpvgqnspqkapyglyaellsgtaftmarselrrtwlyrir
psalhprferlarqplggplgginpnrlrwspqpipaeptdfiegwlpmaanagaekpag
vsiyiyranrsmervffnadgelllvpeqgrlriatelgvmevepleiaviprgmkfrve
lldgqargyiaenhgaplrlpdlgpigsnglanprdfltpvahyeeaegpvqlvqkflge
hwacelqhspldvvawhgsnvpykydlrrfntigtvsfdhpdpsiftvltsptsvhgman
mdfvifpprwmvaentfrppwfhrnlmnefmglingaydakaegflpggaslhgvmsahg
pdaetcekaiaadlaphkidntmafmfetsqvlrpslqalecpqlqadydscwatlpstf
npnrr

SCOPe Domain Coordinates for d4aq6b_:

Click to download the PDB-style file with coordinates for d4aq6b_.
(The format of our PDB-style files is described here.)

Timeline for d4aq6b_: