Lineage for d4iosg_ (4ios G:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1289963Protein automated matches [190119] (16 species)
    not a true protein
  7. 1290216Species Llama (Lama glama) [TaxId:9844] [187485] (60 PDB entries)
  8. 1290300Domain d4iosg_: 4ios G: [196684]
    automated match to d3k80a_
    complexed with gol

Details for d4iosg_

PDB Entry: 4ios (more details), 2.4 Å

PDB Description: structure of phage tp901-1 rbp (orf49) in complex with nanobody 11.
PDB Compounds: (G:) Llama nanobody 11

SCOPe Domain Sequences for d4iosg_:

Sequence, based on SEQRES records: (download)

>d4iosg_ b.1.1.1 (G:) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlvesggglvqagdslrlscavsgrtfssnvigwfrqapgkerefvaaiswstgstyyg
rsmkgrcaasrdnakntvalqlnslkpedtavyycaatldwgktlsdeydywgqgtqvtv

Sequence, based on observed residues (ATOM records): (download)

>d4iosg_ b.1.1.1 (G:) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlvesggglvqagdslrlscavsgrsnvigwfrqapgkerefvaaiswstgstyygrsm
kgrcaasrdnakntvalqlnslkpedtavyycaatldwgktlsdeydywgqgtqvtv

SCOPe Domain Coordinates for d4iosg_:

Click to download the PDB-style file with coordinates for d4iosg_.
(The format of our PDB-style files is described here.)

Timeline for d4iosg_: