Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (24 species) not a true protein |
Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries) |
Domain d4iosg_: 4ios G: [196684] Other proteins in same PDB: d4iosa_, d4iosb_, d4iosc_, d4iosh_ automated match to d3k80a_ complexed with gol |
PDB Entry: 4ios (more details), 2.4 Å
SCOPe Domain Sequences for d4iosg_:
Sequence, based on SEQRES records: (download)
>d4iosg_ b.1.1.1 (G:) automated matches {Llama (Lama glama) [TaxId: 9844]} vqlvesggglvqagdslrlscavsgrtfssnvigwfrqapgkerefvaaiswstgstyyg rsmkgrcaasrdnakntvalqlnslkpedtavyycaatldwgktlsdeydywgqgtqvtv
>d4iosg_ b.1.1.1 (G:) automated matches {Llama (Lama glama) [TaxId: 9844]} vqlvesggglvqagdslrlscavsgrsnvigwfrqapgkerefvaaiswstgstyygrsm kgrcaasrdnakntvalqlnslkpedtavyycaatldwgktlsdeydywgqgtqvtv
Timeline for d4iosg_: