Lineage for d1ehja_ (1ehj A:)
- Root: SCOP 1.59
Class a: All alpha proteins [46456] (151 folds) 
Fold a.138: Multiheme cytochromes [48694] (1 superfamily) Superfamily a.138.1: Multiheme cytochromes [48695] (3 families) 
Family a.138.1.1: Cytochrome c3-like [48696] (3 proteins) 
Protein Cytochrome c7 (cytochrome c551.5) [48703] (1 species) Species Desulfuromonas acetoxidans [TaxId:891] [48704] (6 PDB entries) 
Domain d1ehja_: 1ehj A: [19667]
Details for d1ehja_
PDB Entry: 1ehj (more details)
PDB Description: a proton-nmr investigation of the fully reduced cytochrome c7 from desulfuromonas acetoxidans
SCOP Domain Sequences for d1ehja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ehja_ a.138.1.1 (A:) Cytochrome c7 (cytochrome c551.5) {Desulfuromonas acetoxidans}
advvtyenkkgnvtfdhkahaeklgcdachegtpakiaidkksahkdacktchksnngpt
kcggchik
SCOP Domain Coordinates for d1ehja_:
Click to download the PDB-style file with coordinates for d1ehja_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ehja_:
- d1ehja_ first appeared (with stable ids) in SCOP 1.55
- d1ehja_ appears in SCOP 1.57
- d1ehja_ appears in SCOP 1.61
- d1ehja_ appears in the current release, SCOPe 2.08
View in 3D