PDB entry 1ehj

View 1ehj on RCSB PDB site
Description: a proton-nmr investigation of the fully reduced cytochrome c7 from desulfuromonas acetoxidans
Deposited on 2000-02-21, released 2000-05-10
The last revision prior to the SCOP 1.59 freeze date was dated 2000-05-10, with a file datestamp of 2000-05-10.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.59: d1ehja_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ehjA (A:)
  advvtyenkkgnvtfdhkahaeklgcdachegtpakiaidkksahkdacktchksnngpt
  kcggchik