Lineage for d1new__ (1new -)
- Root: SCOP 1.59
Class a: All alpha proteins [46456] (151 folds) 
Fold a.138: Multiheme cytochromes [48694] (1 superfamily) Superfamily a.138.1: Multiheme cytochromes [48695] (3 families) 
Family a.138.1.1: Cytochrome c3-like [48696] (3 proteins) 
Protein Cytochrome c7 (cytochrome c551.5) [48703] (1 species) Species Desulfuromonas acetoxidans [TaxId:891] [48704] (6 PDB entries) 
Domain d1new__: 1new - [19664]
Details for d1new__
PDB Entry: 1new (more details)
PDB Description: cytochrome c551.5, nmr
SCOP Domain Sequences for d1new__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1new__ a.138.1.1 (-) Cytochrome c7 (cytochrome c551.5) {Desulfuromonas acetoxidans}
advvtyenkkgnvtfdhkahaeklgcdachegtpakiaidkksahkdacktchksnngpt
kcggchik
SCOP Domain Coordinates for d1new__:
Click to download the PDB-style file with coordinates for d1new__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1new__:
- d1new__ first appeared (with stable ids) in SCOP 1.55
- d1new__ appears in SCOP 1.57
- d1new__ appears in SCOP 1.61
- d1new__ appears in the current release, SCOPe 2.08, called d1newa_
View in 3D