PDB entry 1new

View 1new on RCSB PDB site
Description: cytochrome c551.5, nmr
Deposited on 1998-02-10, released 1998-04-29
The last revision prior to the SCOP 1.59 freeze date was dated 1998-04-29, with a file datestamp of 1998-04-29.
Experiment type: NMR18
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.59: d1new__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1new_ (-)
  advvtyenkkgnvtfdhkahaeklgcdachegtpakiaidkksahkdacktchksnngpt
  kcggchik