Lineage for d3kkab_ (3kka B:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1493397Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1493398Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) (S)
  5. 1493535Family a.60.1.0: automated matches [191306] (1 protein)
    not a true family
  6. 1493536Protein automated matches [190031] (2 species)
    not a true protein
  7. 1493541Species Human (Homo sapiens) [TaxId:9606] [188353] (18 PDB entries)
  8. 1493552Domain d3kkab_: 3kka B: [196505]
    automated match to d3kkad_
    complexed with cl

Details for d3kkab_

PDB Entry: 3kka (more details), 2.4 Å

PDB Description: co-crystal structure of the sam domains of epha1 and epha2
PDB Compounds: (B:) Ephrin type-A receptor 1

SCOPe Domain Sequences for d3kkab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kkab_ a.60.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gipyrtvsewlesirmkryilhfhsagldtmecvleltaedltqmgitlpghqkrilcsi
qgf

SCOPe Domain Coordinates for d3kkab_:

Click to download the PDB-style file with coordinates for d3kkab_.
(The format of our PDB-style files is described here.)

Timeline for d3kkab_: