Lineage for d1ef1d_ (1ef1 D:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1750858Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 1750994Superfamily a.137.5: Moesin tail domain [48678] (1 family) (S)
    automatically mapped to Pfam PF00769
  5. 1750995Family a.137.5.1: Moesin tail domain [48679] (1 protein)
  6. 1750996Protein Moesin tail domain [48680] (1 species)
    string of short helices masking the FERM domain surface
  7. 1750997Species Human (Homo sapiens) [TaxId:9606] [48681] (1 PDB entry)
  8. 1750999Domain d1ef1d_: 1ef1 D: [19643]
    Other proteins in same PDB: d1ef1a1, d1ef1a2, d1ef1a3, d1ef1b1, d1ef1b2, d1ef1b3
    complexed with so4

Details for d1ef1d_

PDB Entry: 1ef1 (more details), 1.9 Å

PDB Description: crystal structure of the moesin ferm domain/tail domain complex
PDB Compounds: (D:) moesin

SCOPe Domain Sequences for d1ef1d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ef1d_ a.137.5.1 (D:) Moesin tail domain {Human (Homo sapiens) [TaxId: 9606]}
aeasadlradamakdrseeertteaeknervqkhlkaltselanardeskktandmihae
nmrlgrdkyktlrqirqgntkqridefesm

SCOPe Domain Coordinates for d1ef1d_:

Click to download the PDB-style file with coordinates for d1ef1d_.
(The format of our PDB-style files is described here.)

Timeline for d1ef1d_: