Lineage for d3lbfd_ (3lbf D:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1611695Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 1611696Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 1612879Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 1612880Protein automated matches [190689] (47 species)
    not a true protein
  7. 1612927Species Escherichia coli K-12 [TaxId:83333] [196426] (5 PDB entries)
  8. 1612935Domain d3lbfd_: 3lbf D: [196427]
    automated match to d2yxeb_
    complexed with gol, po4, sah

Details for d3lbfd_

PDB Entry: 3lbf (more details), 1.8 Å

PDB Description: crystal structure of protein l-isoaspartyl methyltransferase from escherichia coli
PDB Compounds: (D:) protein-l-isoaspartate o-methyltransferase

SCOPe Domain Sequences for d3lbfd_:

Sequence, based on SEQRES records: (download)

>d3lbfd_ c.66.1.0 (D:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
srrvqalldqlraqgiqdeqvlnalaavprekfvdeafeqkawdnialpigqgqtisqpy
mvarmtelleltpqsrvleigtgsgyqtailahlvqhvcsverikglqwqarrrlknldl
hnvstrhgdgwqgwqarapfdaiivtaappeiptalmtqldeggilvlpvgeehqylkrv
rrrggefiidtveavrfvplvkgela

Sequence, based on observed residues (ATOM records): (download)

>d3lbfd_ c.66.1.0 (D:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
srrvqalldqlraqgiqdeqvlnalaavprekfawdnialpqgqtisqpymvarmtelle
ltpqsrvleigtgsgyqtailahlvqhvcsverikglqwqarrrlknldlhnvstrhgdg
wqgwqarapfdaiivtaappeiptalmtqldeggilvlpvgeehqylkrvrrrggefiid
tveavrfvplvkgela

SCOPe Domain Coordinates for d3lbfd_:

Click to download the PDB-style file with coordinates for d3lbfd_.
(The format of our PDB-style files is described here.)

Timeline for d3lbfd_: