SCOPe 2.04: Domain d3lbfb_: 3lbf B:

Lineage for d3lbfb_ (3lbf B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families)

5. Family c.66.1.0: automated matches [191451] (1 protein)
   not a true family

6. Protein automated matches [190689] (47 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [196426] (5 PDB entries)

8. Domain d3lbfb_: 3lbf B: [199726]
   automated match to d3lbfd_
   complexed with gol, po4, sah

Details for d3lbfb_

PDB Entry: 3lbf, 1.8 Å

PDB Description: crystal structure of protein l-isoaspartyl methyltransferase from escherichia coli

PDB Compounds: (B:) protein-l-isoaspartate o-methyltransferase

SCOPe Domain Sequences for d3lbfb_:

Sequence; same for both SEQRES and ATOM records:

>d3lbfb_ c.66.1.0 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
vsrrvqalldqlraqgiqdeqvlnalaavprekfvdeafeqkawdnialpigqgqtisqp
ymvarmtelleltpqsrvleigtgsgyqtailahlvqhvcsverikglqwqarrrlknld
lhnvstrhgdgwqgwqarapfdaiivtaappeiptalmtqldeggilvlpvgeehqylkr
vrrrggefiidtveavrfvplvkgela

Timeline for d3lbfb_:

• d3lbfb_ first appeared in SCOPe 2.03
  
• d3lbfb_ appears in SCOPe 2.05
  
• d3lbfb_ appears in the current release, SCOPe 2.08