SCOPe 2.08: Domain d3oicd1: 3oic D:4-250

Lineage for d3oicd1 (3oic D:4-250)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [196388] (13 PDB entries)

8. Domain d3oicd1: 3oic D:4-250 [196389]
   Other proteins in same PDB: d3oica2, d3oicd2
   automated match to d3osua_
   complexed with so4

Details for d3oicd1

PDB Entry: 3oic, 2.2 Å

PDB Description: Crystal Structure of Enoyl-ACP Reductases III (FabL) from B. subtilis (apo form)

PDB Compounds: (D:) Enoyl-[acyl-carrier-protein] reductase [NADPH]

SCOPe Domain Sequences for d3oicd1:

Sequence; same for both SEQRES and ATOM records:

>d3oicd1 c.2.1.0 (D:4-250) automated matches {Bacillus subtilis [TaxId: 1423]}
nkcalvtgssrgvgkaaairlaengynivinyarskkaaletaeeieklgvkvlvvkanv
gqpakikemfqqidetfgrldvfvnnaasgvlrpvmeleethwdwtmninakallfcaqe
aaklmeknggghivsisslgsirylenyttvgvskaalealtrylavelspkqiivnavs
ggaidtdalkhfpnredlledarqntpagrmveikdmvdtveflvsskadmirgqtiivd
ggrsllv

Timeline for d3oicd1:

• d3oicd1 first appeared in SCOPe 2.02, called d3oicd_
  
• d3oicd1 appears in SCOPe 2.07