Lineage for d1b9xb_ (1b9x B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2733644Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 2733784Superfamily a.137.3: Transducin (heterotrimeric G protein), gamma chain [48670] (1 family) (S)
    long alpha-helix interrupted in the middle
    automatically mapped to Pfam PF00631
  5. 2733785Family a.137.3.1: Transducin (heterotrimeric G protein), gamma chain [48671] (2 proteins)
  6. 2733786Protein Transducin (heterotrimeric G protein), gamma chain [48672] (1 species)
  7. 2733787Species Cow (Bos taurus) [TaxId:9913] [48673] (72 PDB entries)
  8. 2733844Domain d1b9xb_: 1b9x B: [19638]
    Other proteins in same PDB: d1b9xa_, d1b9xc_
    complexed with gd

Details for d1b9xb_

PDB Entry: 1b9x (more details), 3 Å

PDB Description: structural analysis of phosducin and its phosphorylation-regulated interaction with transducin
PDB Compounds: (B:) protein (transducin)

SCOPe Domain Sequences for d1b9xb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b9xb_ a.137.3.1 (B:) Transducin (heterotrimeric G protein), gamma chain {Cow (Bos taurus) [TaxId: 9913]}
mpviniedltekdklkmevdqlkkevtlermlvskcceefrdyveersgedplvkgiped
knpfkelk

SCOPe Domain Coordinates for d1b9xb_:

Click to download the PDB-style file with coordinates for d1b9xb_.
(The format of our PDB-style files is described here.)

Timeline for d1b9xb_: