Lineage for d3zr9a_ (3zr9 A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1440053Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 1440054Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 1440394Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 1440395Protein automated matches [190418] (8 species)
    not a true protein
  7. 1440403Species Klebsiella pneumoniae [TaxId:573] [189718] (16 PDB entries)
  8. 1440419Domain d3zr9a_: 3zr9 A: [196335]
    automated match to d3srxa_
    complexed with cd, co, ni, zn

Details for d3zr9a_

PDB Entry: 3zr9 (more details), 1.91 Å

PDB Description: structure of new delhi metallo-beta-lactamase 1 (ndm-1)
PDB Compounds: (A:) Beta-lactamase NDM-1

SCOPe Domain Sequences for d3zr9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zr9a_ d.157.1.0 (A:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
gpgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtawtddqta
qilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmvaaqh
sltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslg
nlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr

SCOPe Domain Coordinates for d3zr9a_:

Click to download the PDB-style file with coordinates for d3zr9a_.
(The format of our PDB-style files is described here.)

Timeline for d3zr9a_: