Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) |
Family d.157.1.0: automated matches [191360] (1 protein) not a true family |
Protein automated matches [190418] (5 species) not a true protein |
Species Klebsiella pneumoniae [TaxId:573] [189718] (11 PDB entries) |
Domain d3zr9a_: 3zr9 A: [196335] automated match to d3srxa_ complexed with cd, co, ni, zn |
PDB Entry: 3zr9 (more details), 1.91 Å
SCOPe Domain Sequences for d3zr9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zr9a_ d.157.1.0 (A:) automated matches {Klebsiella pneumoniae [TaxId: 573]} gpgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtawtddqta qilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmvaaqh sltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslg nlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr
Timeline for d3zr9a_: