Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.39: DLC [54647] (1 superfamily) core: beta-alpha(2)-beta-X-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 1342 |
Superfamily d.39.1: DLC [54648] (1 family) automatically mapped to Pfam PF01221 |
Family d.39.1.1: DLC [54649] (3 proteins) 8 kDa dynein light chain, DLC8 |
Protein automated matches [190350] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [196192] (2 PDB entries) |
Domain d3p8mb_: 3p8m B: [196193] automated match to d1re6a_ |
PDB Entry: 3p8m (more details), 2.9 Å
SCOPe Domain Sequences for d3p8mb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3p8mb_ d.39.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} drkaviknadmsedmqqdavdcatqamekyniekdiaayikkefdkkynptwhcivgrnf gsyvthetkhfiyfylgqvaillfksg
Timeline for d3p8mb_: