SCOPe 2.06: Domain d3q5ob1: 3q5o B:3-100

Lineage for d3q5ob1 (3q5o B:3-100)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)

8. Domain d3q5ob1: 3q5o B:3-100 [196076]
   Other proteins in same PDB: d3q5oa2, d3q5ob2
   automated match to d1u2ha_
   complexed with so4

Details for d3q5ob1

PDB Entry: 3q5o, 2.05 Å

PDB Description: crystal structure of human titin domain m10

PDB Compounds: (B:) titin

SCOPe Domain Sequences for d3q5ob1:

Sequence; same for both SEQRES and ATOM records:

>d3q5ob1 b.1.1.0 (B:3-100) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gippkiealpsdisidegkvltvacaftgeptpevtwscggrkihsqeqgrfhientddl
ttliimdvqkqdgglytlslgnefgsdsatvnihirsi

Timeline for d3q5ob1:

• d3q5ob1 first appeared in SCOPe 2.02, called d3q5ob_
  
• d3q5ob1 was called d3q5ob_ in SCOPe 2.05
  
• d3q5ob1 appears in SCOPe 2.07
  
• d3q5ob1 appears in the current release, SCOPe 2.08