Lineage for d4ddja_ (4ddj A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2716976Fold a.64: Saposin-like [47861] (2 superfamilies)
    5 helices; folded leaf, closed
  4. 2716977Superfamily a.64.1: Saposin [47862] (5 families) (S)
    Lipid-binding can promote conformational changes and oligomerisation in some members
  5. 2716978Family a.64.1.1: NKL-like [47863] (4 proteins)
  6. 2716985Protein Saposin C [89077] (1 species)
  7. 2716986Species Human (Homo sapiens) [TaxId:9606] [89078] (11 PDB entries)
  8. 2716992Domain d4ddja_: 4ddj A: [196036]
    automated match to d2doba_
    complexed with lda

Details for d4ddja_

PDB Entry: 4ddj (more details), 1.9 Å

PDB Description: crystal structure of saposin a in complex with lauryldimethylamine-n- oxide (ldao)
PDB Compounds: (A:) Saposin-A

SCOPe Domain Sequences for d4ddja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ddja_ a.64.1.1 (A:) Saposin C {Human (Homo sapiens) [TaxId: 9606]}
slpcdickdvvtaagdmlkdnateeeilvylektcdwlpkpnmsasckeivdsylpvild
iikgemsrpgevcsalnlce

SCOPe Domain Coordinates for d4ddja_:

Click to download the PDB-style file with coordinates for d4ddja_.
(The format of our PDB-style files is described here.)

Timeline for d4ddja_: