Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (3 proteins) |
Protein automated matches [190183] (5 species) not a true protein |
Species Dengue virus 2 [TaxId:11064] [195986] (1 PDB entry) |
Domain d3uzva_: 3uzv A: [195987] Other proteins in same PDB: d3uzvb1, d3uzvb2 automated match to d2jsfa1 complexed with eoh |
PDB Entry: 3uzv (more details), 2.1 Å
SCOPe Domain Sequences for d3uzva_:
Sequence, based on SEQRES records: (download)
>d3uzva_ b.1.18.4 (A:) automated matches {Dengue virus 2 [TaxId: 11064]} mgmsysmctgkfkivkeiaetqhgtivirvqyegdgspckipfeimdlekrhvlgrlitv npivtekdspvnieaeppfgdsyiiigvepgqlklnwfkk
>d3uzva_ b.1.18.4 (A:) automated matches {Dengue virus 2 [TaxId: 11064]} mgmsysmctgkfkivkeiaetqhgtivirvqyegdgspckipfeimdlhvlgrlitvnpi vtekdspvnieaeppfgdsyiiigvepgqlklnwfkk
Timeline for d3uzva_: