SCOPe 2.05: Domain d3uzva_: 3uzv A:

Lineage for d3uzva_ (3uzv A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (3 proteins)

6. Protein automated matches [190183] (5 species)
   not a true protein

7. Species Dengue virus 2 [TaxId:11064] [195986] (1 PDB entry)

8. Domain d3uzva_: 3uzv A: [195987]
   Other proteins in same PDB: d3uzvb1, d3uzvb2
   automated match to d2jsfa1
   complexed with eoh

Details for d3uzva_

PDB Entry: 3uzv, 2.1 Å

PDB Description: Crystal structure of the dengue virus serotype 2 envelope protein domain III in complex with the variable domains of Mab 4E11

PDB Compounds: (A:) envelope protein

SCOPe Domain Sequences for d3uzva_:

Sequence, based on SEQRES records:

>d3uzva_ b.1.18.4 (A:) automated matches {Dengue virus 2 [TaxId: 11064]}
mgmsysmctgkfkivkeiaetqhgtivirvqyegdgspckipfeimdlekrhvlgrlitv
npivtekdspvnieaeppfgdsyiiigvepgqlklnwfkk

Sequence, based on observed residues (ATOM records):

>d3uzva_ b.1.18.4 (A:) automated matches {Dengue virus 2 [TaxId: 11064]}
mgmsysmctgkfkivkeiaetqhgtivirvqyegdgspckipfeimdlhvlgrlitvnpi
vtekdspvnieaeppfgdsyiiigvepgqlklnwfkk

Timeline for d3uzva_:

• d3uzva_ first appeared in SCOPe 2.02
  
• d3uzva_ appears in SCOPe 2.04
  
• d3uzva_ appears in SCOPe 2.06
  
• d3uzva_ appears in the current release, SCOPe 2.08