Lineage for d1irba_ (1irb A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2345955Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2345956Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2345961Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2345962Protein Phospholipase A2 [48637] (5 species)
  7. 2345963Species Cow (Bos taurus), pancreas [TaxId:9913] [48639] (32 PDB entries)
    Uniprot P00593
  8. 2345982Domain d1irba_: 1irb A: [19586]
    complexed with ca

Details for d1irba_

PDB Entry: 1irb (more details), 1.9 Å

PDB Description: carboxylic ester hydrolase
PDB Compounds: (A:) phospholipase a2

SCOPe Domain Sequences for d1irba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1irba_ a.133.1.2 (A:) Phospholipase A2 {Cow (Bos taurus), pancreas [TaxId: 9913]}
alwqfngmikckipsseplldfnnygcycglggsgtpvddldrccqthdncykqakklds
ckvlvdnpytnnysyscsnneitcssennaceaficncdrnaaicfskvpynkehknlda
anc

SCOPe Domain Coordinates for d1irba_:

Click to download the PDB-style file with coordinates for d1irba_.
(The format of our PDB-style files is described here.)

Timeline for d1irba_: