PDB entry 1irb

View 1irb on RCSB PDB site
Description: carboxylic ester hydrolase
Class: hydrolase
Keywords: hydrolase, enzyme, carboxylic ester hydrolase, lipid degradation
Deposited on 1997-08-13, released 1997-12-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.192
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase a2
    Species: Bos taurus [TaxId:9913]
    Gene: MATURE PLA2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00593 (0-122)
      • engineered (119-120)
    Domains in SCOPe 2.07: d1irba_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1irbA (A:)
    alwqfngmikckipsseplldfnnygcycglggsgtpvddldrccqthdncykqakklds
    ckvlvdnpytnnysyscsnneitcssennaceaficncdrnaaicfskvpynkehknlda
    anc