Lineage for d3axks_ (3axk S:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2957669Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 2957670Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families) (S)
  5. 2957671Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins)
  6. 2957834Protein automated matches [190066] (7 species)
    not a true protein
  7. 2957908Species Oryza sativa [TaxId:39947] [195635] (2 PDB entries)
  8. 2957917Domain d3axks_: 3axk S: [195637]
    Other proteins in same PDB: d3axka1, d3axka2, d3axkb1, d3axkb2
    automated match to d1wdds_
    complexed with gol, mg, ndp

Details for d3axks_

PDB Entry: 3axk (more details), 1.9 Å

PDB Description: Structure of rice Rubisco in complex with NADP(H)
PDB Compounds: (S:) Ribulose bisphosphate carboxylase small chain, chloroplastic

SCOPe Domain Sequences for d3axks_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3axks_ d.73.1.1 (S:) automated matches {Oryza sativa [TaxId: 39947]}
xmqvwpiegikkfetlsylppltvedllkqieyllrskwvpclefskvgfvyrenhrspg
yydgrywtmwklpmfgctdatqvlkeleeakkaypdafvriigfdnvrqvqcisfiaykp
p

SCOPe Domain Coordinates for d3axks_:

Click to download the PDB-style file with coordinates for d3axks_.
(The format of our PDB-style files is described here.)

Timeline for d3axks_: