SCOPe 2.05: Domain d1qlla_: 1qll A:

Lineage for d1qlla_ (1qll A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
   automatically mapped to Pfam PF00068

6. Protein Snake phospholipase A2 [48624] (36 species)

7. Species Bothrops pirajai, Piratoxin-II (PRTX-II) [TaxId:113192] [48633] (3 PDB entries)

8. Domain d1qlla_: 1qll A: [19556]
   complexed with tda

Details for d1qlla_

PDB Entry: 1qll, 2.04 Å

PDB Description: piratoxin-ii (prtx-ii) - a k49 pla2 from bothrops pirajai

PDB Compounds: (A:) phospholipase a2

SCOPe Domain Sequences for d1qlla_:

Sequence; same for both SEQRES and ATOM records:

>d1qlla_ a.133.1.2 (A:) Snake phospholipase A2 {Bothrops pirajai, Piratoxin-II (PRTX-II) [TaxId: 113192]}
slfelgkmilqetgknpaksygaygcncgvlgrgkpkdatdrccyvhkccykkltgcnpk
kdrysyswkdktivcgennpclkelcecdkavaiclrenlgtynkkyryhlkpfckkadk
c

Timeline for d1qlla_:

• d1qlla_ first appeared (with stable ids) in SCOP 1.55
  
• d1qlla_ appears in SCOPe 2.04
  
• d1qlla_ appears in SCOPe 2.06
  
• d1qlla_ appears in the current release, SCOPe 2.08