SCOP 1.63: Domain d1cl5b_: 1cl5 B:

Lineage for d1cl5b_ (1cl5 B:)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulphide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)

6. Protein Snake phospholipase A2 [48624] (19 species)

7. Species Snake (Daboia russelli pulchella) [48630] (6 PDB entries)

8. Domain d1cl5b_: 1cl5 B: [19552]
   complexed with vitamin E

Details for d1cl5b_

PDB Entry: 1cl5, 2.45 Å

PDB Description: crystal structure of phospholipase a2 from daboia russelli pulchella

SCOP Domain Sequences for d1cl5b_:

Sequence; same for both SEQRES and ATOM records:

>d1cl5b_ a.133.1.2 (B:) Snake phospholipase A2 {Snake (Daboia russelli pulchella)}
sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c

Timeline for d1cl5b_:

• d1cl5b_ first appeared (with stable ids) in SCOP 1.55
  
• d1cl5b_ appears in SCOP 1.61
  
• d1cl5b_ appears in SCOP 1.65
  
• d1cl5b_ appears in the current release, SCOPe 2.08