Lineage for d1ppaa_ (1ppa A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1750246Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 1750247Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 1750252Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 1750360Protein Snake phospholipase A2 [48624] (36 species)
  7. 1750409Species Eastern cottonmouth snake (Agkistrodon piscivorus piscivorus) [TaxId:8716] [48629] (2 PDB entries)
  8. 1750412Domain d1ppaa_: 1ppa A: [19550]
    complexed with anl

Details for d1ppaa_

PDB Entry: 1ppa (more details), 2 Å

PDB Description: the crystal structure of a lysine 49 phospholipase a2 from the venom of the cottonmouth snake at 2.0 angstroms resolution
PDB Compounds: (A:) phospholipase a2

SCOPe Domain Sequences for d1ppaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ppaa_ a.133.1.2 (A:) Snake phospholipase A2 {Eastern cottonmouth snake (Agkistrodon piscivorus piscivorus) [TaxId: 8716]}
svlelgkmilqetgknaitsygsygcncgwghrgqpkdatdrccfvhkccykkltdcnhk
tdrysyswknkaiiceeknpclkemcecdkavaiclrenldtynkkykayfklkckkpdt
c

SCOPe Domain Coordinates for d1ppaa_:

Click to download the PDB-style file with coordinates for d1ppaa_.
(The format of our PDB-style files is described here.)

Timeline for d1ppaa_: