Lineage for d1a2ag_ (1a2a G:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2345955Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2345956Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2345961Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2346077Protein Snake phospholipase A2 [48624] (38 species)
  7. 2346137Species Halys viper (Agkistrodon halys) [TaxId:8714] [48628] (9 PDB entries)
  8. 2346164Domain d1a2ag_: 1a2a G: [19546]
    complexed with cl

Details for d1a2ag_

PDB Entry: 1a2a (more details), 2.8 Å

PDB Description: agkistrotoxin, a phospholipase a2-type presynaptic neurotoxin from agkistrodon halys pallas
PDB Compounds: (G:) phospholipase a2

SCOPe Domain Sequences for d1a2ag_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a2ag_ a.133.1.2 (G:) Snake phospholipase A2 {Halys viper (Agkistrodon halys) [TaxId: 8714]}
nllqfnkmikeetgknaipfyafygcycggggngkpkdgtdrccfvhdccygrlvncntk
sdiysyslkegyitcgkgtnceeqicecdrvaaecfrrnldtynngymfyrdskctetse
ec

SCOPe Domain Coordinates for d1a2ag_:

Click to download the PDB-style file with coordinates for d1a2ag_.
(The format of our PDB-style files is described here.)

Timeline for d1a2ag_: