Lineage for d1a2ag_ (1a2a G:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (2 families) 
Family a.133.1.2: Vertebrate phospholipase A2 [48623] (4 proteins) Protein Snake phospholipase A2 [48624] (12 species) 
Species Chinese water moccasin (Agkistrodon halys pallas), different isoforms [48628] (6 PDB entries) 
Domain d1a2ag_: 1a2a G: [19546]
Details for d1a2ag_
PDB Entry: 1a2a (more details), 2.8 Å
PDB Description: agkistrotoxin, a phospholipase a2-type presynaptic neurotoxin from agkistrodon halys pallas
SCOP Domain Sequences for d1a2ag_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a2ag_ a.133.1.2 (G:) Snake phospholipase A2 {Chinese water moccasin (Agkistrodon halys pallas), different isoforms}
nllqfnkmikeetgknaipfyafygcycggggngkpkdgtdrccfvhdccygrlvncntk
sdiysyslkegyitcgkgtnceeqicecdrvaaecfrrnldtynngymfyrdskctetse
ec
SCOP Domain Coordinates for d1a2ag_:
Click to download the PDB-style file with coordinates for d1a2ag_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1a2ag_:
- d1a2ag_ appears in SCOP 1.57
- d1a2ag_ appears in the current release, SCOPe 2.08
View in 3D
