Lineage for d3rj9a_ (3rj9 A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1150729Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1150730Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1151047Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 1151447Protein Drosophila alcohol dehydrogenase [51782] (2 species)
  7. 1151448Species Fly (Drosophila lebanonensis) [TaxId:7225] [51783] (7 PDB entries)
  8. 1151456Domain d3rj9a_: 3rj9 A: [195445]
    automated match to d1sbya_
    complexed with nad; mutant

Details for d3rj9a_

PDB Entry: 3rj9 (more details), 1.98 Å

PDB Description: Structure of alcohol dehydrogenase from Drosophila lebanonesis T114V mutant complexed with NAD+
PDB Compounds: (A:) alcohol dehydrogenase

SCOPe Domain Sequences for d3rj9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rj9a_ c.2.1.2 (A:) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]}
mdltnknvifvaalggigldtsrelvkrnlknfvildrvenptalaelkainpkvnitfh
tydvtvpvaeskkllkkifdqlktvdilingagilddhqiertiainftglvnvttaild
fwdkrkggpggiianicsvtgfnaihqvpvysaskaavvsftnslaklapitgvtaysin
pgitrtplvhtfnswldveprvaelllshptqtseqcgqnfvkaieankngaiwkldlgt
leaiewtkhwdshi

SCOPe Domain Coordinates for d3rj9a_:

Click to download the PDB-style file with coordinates for d3rj9a_.
(The format of our PDB-style files is described here.)

Timeline for d3rj9a_: