Lineage for d4eqib_ (4eqi B:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2618349Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2618350Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2618351Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 2619196Protein automated matches [190161] (30 species)
    not a true protein
  7. 2619555Species Serratia fonticola [TaxId:47917] [195324] (4 PDB entries)
  8. 2619559Domain d4eqib_: 4eqi B: [195330]
    automated match to d1dy6a_
    complexed with edo, na

Details for d4eqib_

PDB Entry: 4eqi (more details), 1.38 Å

PDB Description: Crystal structure of serratia fonticola carbapenemase SFC-1
PDB Compounds: (B:) Carbapenem-hydrolizing beta-lactamase SFC-1

SCOPe Domain Sequences for d4eqib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4eqib_ e.3.1.1 (B:) automated matches {Serratia fonticola [TaxId: 47917]}
asqppqvtvdklkrlendfggrigvyaidtgsnktfgyranerfplcssfkgflaaavls
ksqqqegllnqrirydnrvmephspvtekqittgmtvaelsaatlqysdngaanlllekl
iggpegmtsfmrsigdnvfrldrwelelnsaipgddrdtstpkavaesmqklafgnvlgl
terhqlmdwfkgnttggarirasvpanwvvgdktgtcgvygtandyaviwpvahapivla
vytskpdrnskhsdaviadasrivlesfnidalr

SCOPe Domain Coordinates for d4eqib_:

Click to download the PDB-style file with coordinates for d4eqib_.
(The format of our PDB-style files is described here.)

Timeline for d4eqib_: