SCOPe 2.05: Domain d1pp2l_: 1pp2 L:

Lineage for d1pp2l_ (1pp2 L:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
   automatically mapped to Pfam PF00068

6. Protein Snake phospholipase A2 [48624] (36 species)

7. Species Western diamondback rattlesnake (Crotalus atrox) [TaxId:8730] [48627] (1 PDB entry)

8. Domain d1pp2l_: 1pp2 L: [19525]

Details for d1pp2l_

PDB Entry: 1pp2, 2.5 Å

PDB Description: the refined crystal structure of dimeric phospholipase a2 at 2.5 angstroms. access to a shielded catalytic center

PDB Compounds: (L:) calcium-free phospholipase a2

SCOPe Domain Sequences for d1pp2l_:

Sequence; same for both SEQRES and ATOM records:

>d1pp2l_ a.133.1.2 (L:) Snake phospholipase A2 {Western diamondback rattlesnake (Crotalus atrox) [TaxId: 8730]}
slvqfetlimkiagrsgllwysaygcycgwgghglpqdatdrccfvhdccygkatdcnpk
tvsytyseengeiicggddpcgtqicecdkaaaicfrdnipsydnkywlfppkdcreepe
pc

Timeline for d1pp2l_:

• d1pp2l_ first appeared (with stable ids) in SCOP 1.55
  
• d1pp2l_ appears in SCOPe 2.04
  
• d1pp2l_ appears in SCOPe 2.06
  
• d1pp2l_ appears in the current release, SCOPe 2.08