Class b: All beta proteins [48724] (176 folds) |
Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.4: dUTPase-like [51283] (2 families) forms tight trimer through an additional beta-sheet in each subunit subunit beta-sheets are orthogonally packed around the three-fold axis |
Family b.85.4.1: dUTPase-like [51284] (5 proteins) |
Protein automated matches [190798] (8 species) not a true protein |
Species Chlorella variabilis [TaxId:554065] [195003] (1 PDB entry) |
Domain d3so2a_: 3so2 A: [195004] automated match to d1q5ha_ |
PDB Entry: 3so2 (more details), 1.64 Å
SCOPe Domain Sequences for d3so2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3so2a_ b.85.4.1 (A:) automated matches {Chlorella variabilis [TaxId: 554065]} lrvhllnehavlpkrgsagaagfdlascedtevpargravvktglqiaippgtyarvapr sglavkhfidtgagvvdedyrgevgvvlfnhgetpfqvrrgdrvaqlileriatpevvev esldettrgtggygstg
Timeline for d3so2a_: