Lineage for d3so2a_ (3so2 A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1139618Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 1139747Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 1139748Family b.85.4.1: dUTPase-like [51284] (5 proteins)
  6. 1139893Protein automated matches [190798] (4 species)
    not a true protein
  7. 1139894Species Chlorella variabilis [TaxId:554065] [195003] (1 PDB entry)
  8. 1139895Domain d3so2a_: 3so2 A: [195004]
    automated match to d1q5ha_

Details for d3so2a_

PDB Entry: 3so2 (more details), 1.64 Å

PDB Description: chlorella dutpase
PDB Compounds: (A:) Putative uncharacterized protein

SCOPe Domain Sequences for d3so2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3so2a_ b.85.4.1 (A:) automated matches {Chlorella variabilis [TaxId: 554065]}
lrvhllnehavlpkrgsagaagfdlascedtevpargravvktglqiaippgtyarvapr
sglavkhfidtgagvvdedyrgevgvvlfnhgetpfqvrrgdrvaqlileriatpevvev
esldettrgtggygstg

SCOPe Domain Coordinates for d3so2a_:

Click to download the PDB-style file with coordinates for d3so2a_.
(The format of our PDB-style files is described here.)

Timeline for d3so2a_: